Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 70, mitochondrial (Tmem70)

This Recombinant Mouse Transmembrane protein 70, mitochondrial (Tmem70) spans the amino acid sequence from region 78-253.

Product Specifications

Product Name Alternative

Transmembrane protein 70, mitochondrial

UniProt

Q921N7

Expression Region

78-253

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

FHTQVDKPENGRLIYTGNLARTIFGVKCFSYSTSVVSLAFLPYLLSQNNMMFGSLPLQVL FYGVMGSFTVITPTLLHLLTKGYVIRLYHEATSDTYRAVTYNVMLSETSTVFHQDDVTIP ESAHIFTSFYAKTKSLLVNPALFLNPEDYNHLMGYDKPFTFDMEEVDEKKLHEGEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8 (KRT8) (B22.1), 0.2mg/mL
BNUB1266-500 1x 500 µL

Cytokeratin 8 (KRT8) (B22.1), 0.2mg/mL

Sign In for Pricing
View Details
MAP2 Antibody
KC-45629-01 50 μL

MAP2 Antibody

Sign In for Pricing
View Details
MAP2 Antibody
KC-45629-02 100 µL

MAP2 Antibody

Sign In for Pricing
View Details
MAP2 Antibody
KC-45629-03 1 mL

MAP2 Antibody

Sign In for Pricing
View Details
CD79a (IGA/764), 0.2mg/mL
BNUB0764-500 1x 500 µL

CD79a (IGA/764), 0.2mg/mL

Sign In for Pricing
View Details
GAP43 pSer41 Rabbit Polyclonal Antibody
AP09476PU-S 50 µL

GAP43 pSer41 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details