Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycoplasma arthritidis ATP synthase subunit b (atpF)

This Recombinant Mycoplasma arthritidis ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-176.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

B3PLV4

Expression Region

1-176

Origin

Mycoplasma arthritidis (strain 158L3-1)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNFNINQSSISDAITKTFGNLTINWPFFVFSFLTLILVVTIVTLLVYKPLKKMLKNRQNF IQNNIDESIKAKEAALKVQEEIDEKIIESSKHANQIIEQAKLERERIINNGIEVSNKKAE IIIEQANILVTKSQAEFENKQRKIIVENAVEIAKKIIGREIRDKDNLKMIEEMLES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NMDAR1 (GRIN1) (NM_000832) Human Recombinant Protein
TP319368 20 µg

NMDAR1 (GRIN1) (NM_000832) Human Recombinant Protein

Sign In for Pricing
View Details
Human AF10 (mLLT10) activation kit by CRISPRa
GA105387 1 Kit

Human AF10 (mLLT10) activation kit by CRISPRa

Sign In for Pricing
View Details
Esculin
TRC-E658850-25G 25 g

Esculin

Sign In for Pricing
View Details
HU 210
TRC-H673500-5MG 5 mg

HU 210

Sign In for Pricing
View Details
Recombinant Human STK4/MST1 Protein (His Tag)
PKSH030365 50 µg

Recombinant Human STK4/MST1 Protein (His Tag)

Sign In for Pricing
View Details
Ametryn
TRC-A576400-5G 5 g

Ametryn

Sign In for Pricing
View Details