Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycoplasma arthritidis ATP synthase subunit b (atpF)

This Recombinant Mycoplasma arthritidis ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-176.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

B3PLV4

Expression Region

1-176

Origin

Mycoplasma arthritidis (strain 158L3-1)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNFNINQSSISDAITKTFGNLTINWPFFVFSFLTLILVVTIVTLLVYKPLKKMLKNRQNF IQNNIDESIKAKEAALKVQEEIDEKIIESSKHANQIIEQAKLERERIINNGIEVSNKKAE IIIEQANILVTKSQAEFENKQRKIIVENAVEIAKKIIGREIRDKDNLKMIEEMLES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant NRF2 Antibody
RC-16751-01 50 μL

Recombinant NRF2 Antibody

Sign In for Pricing
View Details
Recombinant NRF2 Antibody
RC-16751-02 100 µL

Recombinant NRF2 Antibody

Sign In for Pricing
View Details
Recombinant NRF2 Antibody
RC-16751-03 1 mL

Recombinant NRF2 Antibody

Sign In for Pricing
View Details
C19orf69 (ERICH4) (NM_001130514) Human Over-expression Lysate
LY427223 100 µg

C19orf69 (ERICH4) (NM_001130514) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant BAX Antibody
RC-16759-01 50 μL

Recombinant BAX Antibody

Sign In for Pricing
View Details
Recombinant BAX Antibody
RC-16759-02 100 µL

Recombinant BAX Antibody

Sign In for Pricing
View Details