Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Coprinopsis cinerea Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)

This Recombinant Coprinopsis cinerea Altered inheritance of mitochondria protein 31, mitochondrial (AIM31) spans the amino acid sequence from region 1-177.

Product Specifications

Product Name Alternative

Altered inheritance of mitochondria protein 31, mitochondrial

UniProt

A8P006

Expression Region

1-177

Origin

Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) (Inky cap fungus) (Hormographiella aspergillata)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPDSTRVATVYPPGYETWGEKFQRKFKENPWVPLGCLATCGALLMSAVKMRQGRSKEMNY WMRARVGLQGLTLVALVAGSMALKAAKEKAELEAANAPELTQEQIRQLEKEKEEFEMRLK EAEYSHAQEMALAAGANVRKAKTAEAAQKSAAVGVEVDTENRPSTPAPSGKSWWKMW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEMA6D Antibody
KC-3864-01 50 μL

SEMA6D Antibody

Sign In for Pricing
View Details
SEMA6D Antibody
KC-3864-02 100 µL

SEMA6D Antibody

Sign In for Pricing
View Details
SEMA6D Antibody
KC-3864-03 1 mL

SEMA6D Antibody

Sign In for Pricing
View Details
Human WFDC12 activation kit by CRISPRa
GA115048 1 Kit

Human WFDC12 activation kit by CRISPRa

Sign In for Pricing
View Details
Glypican 5 (GPC5) Human Gene Knockout Kit (CRISPR)
KN207909RB 1 Kit

Glypican 5 (GPC5) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS507091 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details