Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yopI (yopI)

This Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yopI (yopI) spans the amino acid sequence from region 1-177.

Product Specifications

Product Name Alternative

SPBc2 prophage-derived uncharacterized protein yopI

UniProt

O31929

Expression Region

1-177

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNIGEIISNFEGIIGALLGVIVTLILTHILKHFGQIKFYIVDFEIYFKTDNDGWGTNVM PSKDEAKQIEIHSQIEIYNGAEIPKVLREIKFCFYKNTNLIVSVTPDDKATTEEFAEFGY YRDKLFNINLPSKQIIAINIIKFLNEKETKQVKKCNRVYLEAKDHNGKMYKVFLGEF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Hydroxyphenylacetone
TRC-H973030-500MG 500 mg

4-Hydroxyphenylacetone

Sign In for Pricing
View Details
FBL3A CRISPR Activation Plasmid (m)
sc-424502-ACT 20 µg

FBL3A CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Lentiviral mouse Atrnl1 shRNA (UAS) - Lentiviral mouse Atrnl1 shRNA (UAS, RFP) (100)
GTR15229224 1 Vial

Lentiviral mouse Atrnl1 shRNA (UAS) - Lentiviral mouse Atrnl1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
C14orf49 Protein Lysate (Human) with C-Ha Tag
13860031 100 µg

C14orf49 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
PSK2 Rabbit Polyclonal Antibody
APRab16603-01 20 µL

PSK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PSK2 Rabbit Polyclonal Antibody
APRab16603-02 50 µL

PSK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details