Recombinant Mouse Lipoma HMGIC fusion partner (Lhfp)
This Recombinant Mouse Lipoma HMGIC fusion partner (Lhfp) spans the amino acid sequence from region 24-200.
Product Specifications
Product Name Alternative
Lipoma HMGIC fusion partner
UniProt
Q8BM86
Expression Region
24-200
Origin
Mus musculus (Mouse)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
CVGFFMPYWLWGSQLGKPVSFGTFRRCSYPVHDESRQMMVMVEECGRYASFQGIPSTEWR ICTIVTGLGCGLLLLVALTALMGCCVSELISRTVGRVAGGIQFLGGLLIGAGCALYPLGW DSEEVRQTCGYISGQFDLGKCEIGWAYYCTGAGAAAAMLLCTWMACFSGKKQKHYPY
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680225-100 1x 100 µL
Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881953-100 1x 100 µL
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941531-500 1x 500 µL
IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/1531), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB0633-500 1x 500 µL
Von Willebrand Factor (3E2D10), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details