Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit b (atpF)

This Recombinant ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-177.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q73X55

Expression Region

1-177

Origin

Mycobacterium paratuberculosis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDASLSVLASSQVVAEGGNNFLVPNGTFFFVLAIFLIVLAVIGTFVVPPVMKVLRERDA MVAKTAADNRKAAEQFEAAQADYEEAMTEARVQASSLRDNARAEGRKVVEDARAKAEQEV LSTLQLAARQLKRERDAVELDLRANVASMSATLASRILGVDVAPAAATTSATKTSGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM134B Rabbit pAb
orb2718520-01 50 µL

FAM134B Rabbit pAb

Sign In for Pricing
View Details
FAM134B Rabbit pAb
orb2718520-02 100 µL

FAM134B Rabbit pAb

Sign In for Pricing
View Details
LRFN4 Rabbit pAb, BF700 conjugated
orb2878365 100 µL

LRFN4 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Mouse Progesterone Receptor, PGR GENLISA ELISA
KLM0490 96 Well

Mouse Progesterone Receptor, PGR GENLISA ELISA

Sign In for Pricing
View Details
ACBD3 (Biotin)
554204-01 50 µg

ACBD3 (Biotin)

Sign In for Pricing
View Details
ACBD3 (Biotin)
554204-02 100 µg

ACBD3 (Biotin)

Sign In for Pricing
View Details