Recombinant Saccharomyces cerevisiae Mitochondrial inner membrane protease subunit 2 (IMP2)
This Recombinant Saccharomyces cerevisiae Mitochondrial inner membrane protease subunit 2 (IMP2) spans the amino acid sequence from region 1-177.
Product Specifications
Product Name Alternative
Mitochondrial inner membrane protease subunit 2, EC= 3.4.21.-
UniProt
P46972
Expression Region
1-177
Origin
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MFRAGSSKRFLRNTLIAISWVPVLLTINNNVVHIAQVKGTSMQPTLNPQTETLATDWVLL WKFGVKNPSNLSRDDIILFKAPTNPRKVYCKRVKGLPFDTIDTKFPYPKPQVNLPRGHIW VEGDNYFHSIDSNTFGPISSGLVIGKAITIVWPPSRWGTDLKLSTGRDCISKRAILE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740669-100 1x 100 µL
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941714-500 1x 500 µL
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/1714), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882224-500 1x 500 µL
S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) (CPTC-S100A4-3), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682207-100 1x 100 µL
HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (rGROEL/780), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 