Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Exiguobacterium sibiricum ATP synthase subunit b (atpF)

This Recombinant Exiguobacterium sibiricum ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-177.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

B1YMR8

Expression Region

1-177

Origin

Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLTYRAAEGVAESNHLLLANMIVTIVVFLLLLILLKKFAWGPLVNMMKAREEHVASEIN SAEKSRKDAEVYVEQQQAELNKARTEARDLLEASRRQAEAEQARAMEQARVETELSKEEA RRAIERERAEAQAALKNDVALQAIAAARHVMKTQLATDEAAQRALVDQFLADTKGTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF680R conjugate, 0.1mg/mL
BNC810322-500 1x 500 µL

CD3e (RIV9), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF740 conjugate, 0.1mg/mL
BNC740994-100 1x 100 µL

TNF alpha (J2D10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF568 conjugate, 0.1mg/mL
BNC680160-100 1x 100 µL

CD20 (B9E9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/144B), CF647 conjugate, 0.1mg/mL
BNC470749-100 1x 100 µL

CD8 (C8/144B), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Progesterone Receptor (PR500), CF647 conjugate, 0.1mg/mL
BNC470500-500 1x 500 µL

Progesterone Receptor (PR500), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymidylate Synthase (TS106 + TMS715), CF647 conjugate, 0.1mg/mL
BNC470716-100 1x 100 µL

Thymidylate Synthase (TS106 + TMS715), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details