Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium abscessus ATP synthase subunit b (atpF)

This Recombinant Mycobacterium abscessus ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-177.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

B1MLV8

Expression Region

1-177

Origin

Mycobacterium abscessus (strain ATCC 19977 / DSM 44196)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGELHSVASAVTAVAAEAAEEGGKQNNFLIPNGTFFVVLAIFLIVLAVIGTFVVPPIQKV LKAREDMVTKTAEDNRNAAEQFTAAEADYKDELAKARGAATAVRDEARAEGRGILEDMRQ RANAEATAVTETAAAELARQGEVTAGELATNVDSLSRTLAERVLGVSLSEPANAGRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Nitrobenzoic Acid
TRC-N493515-5G 5 g

2-Nitrobenzoic Acid

Sign In for Pricing
View Details
PerCP Anti-Mouse CD48 Antibody[HM48-1]
E-AB-F1017UF-01 25 µg

PerCP Anti-Mouse CD48 Antibody[HM48-1]

Sign In for Pricing
View Details
PerCP Anti-Mouse CD48 Antibody[HM48-1]
E-AB-F1017UF-02 100 µg

PerCP Anti-Mouse CD48 Antibody[HM48-1]

Sign In for Pricing
View Details
HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (HSPD1/2206R), CF488A conjugate, 0.1mg/mL
BNC882206-100 1x 100 µL

HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (HSPD1/2206R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MZ2E/838), CF740 conjugate, 0.1mg/mL
BNC740838-100 1x 100 µL

MAGE A1 (MZ2E/838), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Aprataxin (APTX) Rabbit Polyclonal Antibody
TA368917 100 µL

Aprataxin (APTX) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details