Recombinant Prochlorococcus marinus Cytochrome b6-f complex iron-sulfur subunit (petC)
This Recombinant Prochlorococcus marinus Cytochrome b6-f complex iron-sulfur subunit (petC) spans the amino acid sequence from region 1-178.
Product Specifications
Product Name Alternative
Cytochrome b6-f complex iron-sulfur subunit, EC= 1.10.9.1, Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein, ISP, RISP, Rieske iron-sulfur protein
UniProt
A2C0R9
Expression Region
1-178
Origin
Prochlorococcus marinus (strain NATL1A)
Field of Research
Pharmacology & Drug Discovery
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MTQMTTADVPSMGRRQFMNLLTFGTVTGVALGALYPVAQYFTPYRAGGGGGGTNAKDELG NNVSASGWLSTHPVGDRSLVQGLKGDPTYLIVEGEDAITSYGINAICTHLGCVVPWNSGA NKYMCPCHGSQYDSTGKVVRGPAPLSLAIAHVSIEDDQVLVSQWTETDFRTGTDPWWG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740391-500 1x 500 µL
CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740026-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880965-500 1x 500 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 