Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome b6-f complex iron-sulfur subunit (petC)

This Recombinant Prochlorococcus marinus Cytochrome b6-f complex iron-sulfur subunit (petC) spans the amino acid sequence from region 1-178.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex iron-sulfur subunit, EC= 1.10.9.1, Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein, ISP, RISP, Rieske iron-sulfur protein

UniProt

A8G3H7

Expression Region

1-178

Origin

Prochlorococcus marinus (strain MIT 9215)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTQLSSKDVPSMGRRQFMNLLTFGTATGVALGALYPVANYFMPLRAGGGGGGTSAKDELG NPITKTGWLATHQAGDRSLVQGLKGDPTYLIVNEGGGIGEFGLNAICTHLGCVVPWDSGA NKFICPCHGSQYDTNGKVVRGPAPLSLALAHVDIEDDAVLVKQWSETDFRTNENPWWA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Trichinella antibody ELISA KIT
ED0503Hu-01 96 Well

Human Trichinella antibody ELISA KIT

Sign In for Pricing
View Details
Human Trichinella antibody ELISA KIT
ED0503Hu-02 5x 96 Tests

Human Trichinella antibody ELISA KIT

Sign In for Pricing
View Details
Human Trichinella antibody ELISA KIT
ED0503Hu-03 10x 96 Tests

Human Trichinella antibody ELISA KIT

Sign In for Pricing
View Details
CSK antibody
70R-31712 0.1 mg

CSK antibody

Sign In for Pricing
View Details
Recombinant Treponema Pallidum proC Protein (aa 1-263)
VAng-Cr1613-50gEcoli 50 µg (E. coli)

Recombinant Treponema Pallidum proC Protein (aa 1-263)

Sign In for Pricing
View Details
Lentiviral human AKR1D1 sgRNA gene knockout kit - Lentiviral human AKR1D1 sgRNA gene knockout kit (100)
GTR15369379 1 Vial

Lentiviral human AKR1D1 sgRNA gene knockout kit - Lentiviral human AKR1D1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details