Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yopH (yopH)

This Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yopH (yopH) spans the amino acid sequence from region 1-178.

Product Specifications

Product Name Alternative

SPBc2 prophage-derived uncharacterized protein yopH

UniProt

O31930

Expression Region

1-178

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDQNEKSPSWVGDIIKLSPKYLLGLAVFSGIGLWLGNVGLGKTLGIKDAINSYKLYLGL VFLASTSFILSHFIWWISLGIKNKIDQKYSYKLQKERLRNLNRREKQILSPYIFDDVRSV ELSITDGTAQELEHLKIIYRSSNISNRGSYFAYNIQPWARGYLTKNKHLLHESIDHIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Interleukin 9 (IL9) ELISA Kit
orb1665364-01 48 Tests

Rat Interleukin 9 (IL9) ELISA Kit

Sign In for Pricing
View Details
Rat Interleukin 9 (IL9) ELISA Kit
orb1665364-02 96 Tests

Rat Interleukin 9 (IL9) ELISA Kit

Sign In for Pricing
View Details
Agitator and sparger pipe for 0.4 l vessel
800031-04 1 Piece

Agitator and sparger pipe for 0.4 l vessel

Sign In for Pricing
View Details
Double Beam Spectrophotometer
LX242DS 1 Unit

Double Beam Spectrophotometer

Sign In for Pricing
View Details
Compound NP-014921
MBS5794684 Inquire

Compound NP-014921

Sign In for Pricing
View Details
Rabbit Polyclonal Nanos2 Antibody
NBP1-76370 0.1 mg

Rabbit Polyclonal Nanos2 Antibody

Sign In for Pricing
View Details