Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Cytochrome b6-f complex iron-sulfur subunit (petC)

This Recombinant Synechococcus sp. Cytochrome b6-f complex iron-sulfur subunit (petC) spans the amino acid sequence from region 1-178.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex iron-sulfur subunit, EC= 1.10.9.1, Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein, ISP, RISP, Rieske iron-sulfur protein

UniProt

Q0I872

Expression Region

1-178

Origin

Synechococcus sp. (strain CC9311)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTQMPASDVPGMGRRQFMNLLTFGSVTGVALGALYPVANYFIPPRAAGGGGGTSAKDELG NSVTASGWLSSHAEGDRSLVQGLKGDPTYLIVEGVDAIGSYGINAICTHLGCVVPWNSGA NKFMCPCHGSQYDATGKVVRGPAPLSLALANVSVDNDNVFVSQWTETDFRTGEKPWWS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAG-72 / CA72.4 (B72.3), CF568 conjugate, 0.1mg/mL
BNC680276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL
BNC400679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL
BNC551050-500 1x 500 µL

CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL
BNC470034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF740 conjugate, 0.1mg/mL
BNC740851-100 1x 100 µL

HSP60 (LK1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF594 conjugate, 0.1mg/mL
BNC940146-100 1x 100 µL

CD10 (CB-CALLA), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details