Recombinant Synechococcus sp. Photosystem I assembly protein Ycf4 (ycf4)
This Recombinant Synechococcus sp. Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-178.
Product Specifications
Product Name Alternative
Photosystem I assembly protein Ycf4
UniProt
Q3AZ40
Expression Region
1-178
Origin
Synechococcus sp. (strain CC9902)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSAAVLEQSVLGSRRLSNFLVAAAVSVGGVGFLLASLSSYLGQDLLPFGHPAALIFVPQG LVMGLYSIAAALLASYLWYVIAVDVGSGSNRFDKESGVVVISRRGFRRPVCVEFPLKDVK AVKVEVRDGFNARRRVSLRLQGRRDLPLTRVGEPLPLAQLEQEGAELARFLGVNLEGL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
X9505-12-APC 100 µL
XRCC5 (X Ray Repair Complementing Defective Repair in Chinese Hamster Cells 5 (Double-strand-break Rejoining), X-ray Repair Cross-complementing Protein 5, 86kD Subunit of Ku Antigen, ATP Dependent DNA Helicase 2 Subunit 2, ATP-dependent DNA Helicase II, ATP-dependent DNA Helicase II 80kD Subunit, CTC Box Binding Factor 85kD, CTC85, CTCBF, DNA Repair Protein XRCC5, FLJ39089, G22P2, Ku 80, Ku80, Ku Autoantigen 80kD, Ku 86, Ku86, Ku86 Autoantigen-related Protein 1, KARP1, KARP-1, KUB2, Lupus Ku Autoantigen Protein p86, Nuclear Factor IV, NFIV, Thyroid Lupus Autoantigen, TLAA) (APC) discontinued
Sign In for Pricing
View Details 
