Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macrocystis pyrifera Fucoxanthin-chlorophyll a-c binding protein D, chloroplastic (FCPD)

This Recombinant Macrocystis pyrifera Fucoxanthin-chlorophyll a-c binding protein D, chloroplastic (FCPD) spans the amino acid sequence from region 5-182.

Product Specifications

Product Name Alternative

Fucoxanthin-chlorophyll a-c binding protein D, chloroplastic

UniProt

Q40298

Expression Region

5-182

Origin

Macrocystis pyrifera (Giant kelp)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SFELEIGAQAPLGFWDPLGLLADADQERFERLRYVEVKHGRIAMLAIAGHLTQQNARLPG MLSNSANLSFADMPNGVAALSKIPPGGLAQIFGFIGFLELAVMKNVEGSFPGDFTLGGNP FASSWDAMSEETQESKRAIELNNGRAAQMGILALMVHEELNNKPYVINDLLGASYNFN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL
BNC041429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL
BNC040525-500 1x 500 µL

CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF640R conjugate, 0.1mg/mL
BNC400322-100 1x 100 µL

CD3e (RIV9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL
BNC940181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Catenin, beta (CTNNB1) (CTNNB1/2030R), CF640R conjugate, 0.1mg/mL
BNC402030-100 1x 100 µL

Catenin, beta (CTNNB1) (CTNNB1/2030R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL
BNC400266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details