Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macrocystis pyrifera Fucoxanthin-chlorophyll a-c binding protein C, chloroplastic (FCPC)

This Recombinant Macrocystis pyrifera Fucoxanthin-chlorophyll a-c binding protein C, chloroplastic (FCPC) spans the amino acid sequence from region 39-216.

Product Specifications

Product Name Alternative

Fucoxanthin-chlorophyll a-c binding protein C, chloroplastic

UniProt

Q40299

Expression Region

39-216

Origin

Macrocystis pyrifera (Giant kelp)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SFESEIGAQAPLGFWDPLGLLEDADQDAFERLRYVEVKLGRIAMLAIAGHLTQQNARLPG MLSNSANLSFADMPNGVAALSKIPPGGLAQIFGFIGFLELAVMKNVEGSFPGDFTLGGNP FASSWDAMSAETQASKRAIELNNGRAAQMGILALMVHEELNNKPYVINDLLGASYNFN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL
BNC940218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL
BNC040270-500 1x 500 µL

Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL
BNC740181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF640R conjugate, 0.1mg/mL
BNC400745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (C4/206), CF594 conjugate, 0.1mg/mL
BNC940206-500 1x 500 µL

CD4 (C4/206), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (8G7G3/1), CF640R conjugate, 0.1mg/mL
BNC400448-500 1x 500 µL

TTF-1 / NKX2.1 (8G7G3/1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details