Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus subsp. pastoris Cytochrome b6-f complex iron-sulfur subunit (petC)

This Recombinant Prochlorococcus marinus subsp. pastoris Cytochrome b6-f complex iron-sulfur subunit (petC) spans the amino acid sequence from region 1-178.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex iron-sulfur subunit, EC= 1.10.9.1, Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein, ISP, RISP, Rieske iron-sulfur protein

UniProt

Q7V2L4

Expression Region

1-178

Origin

Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTQLSSNDVPSMGRRQFMNLLTFGTATGVALGALYPVANYFMPLRAGGGGGGTSAKDELG NPVTKTGWLASHQAGDRSLVQGLKGDPTYLIVNSEGEIGEFGLNAICTHLGCVVPWDSGA NKFICPCHGSQYDTNGKVVRGPAPLSLALAHVDVDDDAVLVKQWSETDFRTNENPWWA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD41 Monoclonal Antibody(Q90)
JOT-MCA0306-01 20 µL

CD41 Monoclonal Antibody(Q90)

Sign In for Pricing
View Details
CD41 Monoclonal Antibody(Q90)
JOT-MCA0306-02 50 μL

CD41 Monoclonal Antibody(Q90)

Sign In for Pricing
View Details
CD41 Monoclonal Antibody(Q90)
JOT-MCA0306-03 100 µL

CD41 Monoclonal Antibody(Q90)

Sign In for Pricing
View Details
Hsa-miR-758-5p miRNA Mimic
CMH1921-01 5 nmol

Hsa-miR-758-5p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-758-5p miRNA Mimic
CMH1921-02 10 nmol

Hsa-miR-758-5p miRNA Mimic

Sign In for Pricing
View Details
5'-Deoxy-2',3'-O-isopropylidene-5-fluorouridine
MBS6038839-01 100 mg

5'-Deoxy-2',3'-O-isopropylidene-5-fluorouridine

Sign In for Pricing
View Details