Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Synechococcus sp. Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-178.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

Q7U8E3

Expression Region

1-178

Origin

Synechococcus sp. (strain WH8102)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSAEVLEQPVLGSRRLSNYLVAAAVSIGGIGFLLASLSSYLGRDLLPLGHPAALIFVPQG LVMGLYSIAAALLATYLWYVIAVDVGGGSNRFDKAAGVVTVSRRGFRKPVLVEIPLKDVK AVKVEVRDGFNARRRVALRIQGRRDMPLTRVGEPLPLAQLEQDGAELARFLGVNLEGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GOLPH3 activation kit by CRISPRa
GA111961 1 Kit

Human GOLPH3 activation kit by CRISPRa

Sign In for Pricing
View Details
LOC100288966 Human Gene Knockout Kit (CRISPR)
KN434495 1 Kit

LOC100288966 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PTH / Parathyroid Hormone (N-Terminal) (3H9), CF555 conjugate, 0.1mg/mL
BNC550242-500 1x 500 µL

PTH / Parathyroid Hormone (N-Terminal) (3H9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Praf2 (NM_138602) Mouse Tagged ORF Clone
MG201577 10 µg

Praf2 (NM_138602) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ProLite™ FAST Blue Protein Gel Stain *200 Gels*
18002-AAT 1 Set

ProLite™ FAST Blue Protein Gel Stain *200 Gels*

Sign In for Pricing
View Details
PYK2 (PTK2B) pTyr402 Rabbit Polyclonal Antibody
AP02475PU-N 100 µL

PYK2 (PTK2B) pTyr402 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details