Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Synechococcus sp. Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-178.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

Q7U8E3

Expression Region

1-178

Origin

Synechococcus sp. (strain WH8102)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSAEVLEQPVLGSRRLSNYLVAAAVSIGGIGFLLASLSSYLGRDLLPLGHPAALIFVPQG LVMGLYSIAAALLATYLWYVIAVDVGGGSNRFDKAAGVVTVSRRGFRKPVLVEIPLKDVK AVKVEVRDGFNARRRVALRIQGRRDMPLTRVGEPLPLAQLEQDGAELARFLGVNLEGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PEX14 Rabbit Polyclonal Antibody
TA361989 100 µL

PEX14 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tlr6 (N-term) Rabbit Polyclonal Antibody
AP11537PU-N 400 µL

Tlr6 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Electric OR table BOPT-106
BOPT-106 1 Unit

Electric OR table BOPT-106

Sign In for Pricing
View Details
FLCN (NM_144997) Human Recombinant Protein
TP320396 20 µg

FLCN (NM_144997) Human Recombinant Protein

Sign In for Pricing
View Details
CPM Antibody
8C14962-AAT 50 µg

CPM Antibody

Sign In for Pricing
View Details
LILRB2 Antibody
KC-2512-01 50 μL

LILRB2 Antibody

Sign In for Pricing
View Details