Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Synechococcus sp. Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-178.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

Q7U8E3

Expression Region

1-178

Origin

Synechococcus sp. (strain WH8102)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSAEVLEQPVLGSRRLSNYLVAAAVSIGGIGFLLASLSSYLGRDLLPLGHPAALIFVPQG LVMGLYSIAAALLATYLWYVIAVDVGGGSNRFDKAAGVVTVSRRGFRKPVLVEIPLKDVK AVKVEVRDGFNARRRVALRIQGRRDMPLTRVGEPLPLAQLEQDGAELARFLGVNLEGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (ATRX/2900R), Biotin conjugate, 0.1mg/mL
BNCB2900-100 1x 100 µL

ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (ATRX/2900R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ELP4 (NM_019040) Human Recombinant Protein
TP319128 20 µg

ELP4 (NM_019040) Human Recombinant Protein

Sign In for Pricing
View Details
p21 Ras (HRAS) Rabbit Monoclonal Antibody
TA422325 100 µL

p21 Ras (HRAS) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Cytokeratin-6A Antibody
KC-1162-01 50 μL

Cytokeratin-6A Antibody

Sign In for Pricing
View Details
Cytokeratin-6A Antibody
KC-1162-02 100 µL

Cytokeratin-6A Antibody

Sign In for Pricing
View Details
Cytokeratin-6A Antibody
KC-1162-03 1 mL

Cytokeratin-6A Antibody

Sign In for Pricing
View Details