Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein dct-5 (dct-5)

This Recombinant Protein dct-5 (dct-5) spans the amino acid sequence from region 1-179.

Product Specifications

Product Name Alternative

Protein dct-5, Daf-16/foxo controlled, germline tumor affecting protein 5

UniProt

A8WUE9

Expression Region

1-179

Origin

Caenorhabditis briggsae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGIFLGLVDSSSPKSSTSCSLMTSCAVEKCLNKDMVRKIVIESSREEVFGNLVEKFDMVC IAAKCGNECSQCKHCHYALEQMSALAQGEKTSGLCPKLETCVFNCLTEDVSKVLSCVATR CNVHCYDGDCPSCKMISRRIFSTICKQHSMTSQPQIKYEGTCPNLFMELADHYVAKKKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LDHA (NM_001165414) Human Over-expression Lysate
LC431321 20 µg

LDHA (NM_001165414) Human Over-expression Lysate

Sign In for Pricing
View Details
PPM1D Polyclonal Antibody
E-AB-52172-01 20 µL

PPM1D Polyclonal Antibody

Sign In for Pricing
View Details
PPM1D Polyclonal Antibody
E-AB-52172-02 60 µL

PPM1D Polyclonal Antibody

Sign In for Pricing
View Details
PPM1D Polyclonal Antibody
E-AB-52172-03 120 µL

PPM1D Polyclonal Antibody

Sign In for Pricing
View Details
PPM1D Polyclonal Antibody
E-AB-52172-04 200 µL

PPM1D Polyclonal Antibody

Sign In for Pricing
View Details
Sodium Chlorite (Technical Grade)
TRC-S615190-50G 50 g

Sodium Chlorite (Technical Grade)

Sign In for Pricing
View Details