Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Transmembrane protein 208 (TMEM208)

This Recombinant Chicken Transmembrane protein 208 (TMEM208) spans the amino acid sequence from region 1-179.

Product Specifications

Product Name Alternative

Transmembrane protein 208

UniProt

Q5ZK32

Expression Region

1-179

Origin

Gallus gallus (Chicken)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPKGKAGTKGKKQIFEENRETLRFYLRIILGASAVYAAVNLVVFYPAASAWTWLAFAFS SAVYGASYRSMSSMARPAFADDGSLADGGIDLNMEQGWQSECPHPHEPRHLKDVILLTAM VQVLSCFSLYVWYFWLLAPGRALYLLWVNILGPWFTAESSAPGQEPNEKKQRRTGTPPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tnf Mouse Gene Knockout Kit (CRISPR)
KN317964 1 Kit

Tnf Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Neurovascular bundle
CS643608 5x 5 µm

Frozen Tissue Sections, Neurovascular bundle

Sign In for Pricing
View Details
Horn, 3mm diameter, for 3-10ml, fits DP0150
DP0150-3 1 Each

Horn, 3mm diameter, for 3-10ml, fits DP0150

Sign In for Pricing
View Details
ReadiUse™ Preactivated APC
2561-AAT 1 mg

ReadiUse™ Preactivated APC

Sign In for Pricing
View Details
TNFRSF14 Recombinant Rabbit monoclonal Antibody
HA751042 100 µL

TNFRSF14 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Cytochrome P450 1A1/1A2 (MC1), CF640R conjugate, 0.1mg/mL
BNC402907-100 1x 100 µL

Cytochrome P450 1A1/1A2 (MC1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details