Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Transmembrane protein 208 (TMEM208)

This Recombinant Chicken Transmembrane protein 208 (TMEM208) spans the amino acid sequence from region 1-179.

Product Specifications

Product Name Alternative

Transmembrane protein 208

UniProt

Q5ZK32

Expression Region

1-179

Origin

Gallus gallus (Chicken)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPKGKAGTKGKKQIFEENRETLRFYLRIILGASAVYAAVNLVVFYPAASAWTWLAFAFS SAVYGASYRSMSSMARPAFADDGSLADGGIDLNMEQGWQSECPHPHEPRHLKDVILLTAM VQVLSCFSLYVWYFWLLAPGRALYLLWVNILGPWFTAESSAPGQEPNEKKQRRTGTPPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-(3-Thienyl)acrylic Acid
TRC-T430030-50MG 50 mg

3-(3-Thienyl)acrylic Acid

Sign In for Pricing
View Details
MBP Antibody
KC-1196-01 50 μL

MBP Antibody

Sign In for Pricing
View Details
MBP Antibody
KC-1196-02 100 µL

MBP Antibody

Sign In for Pricing
View Details
MBP Antibody
KC-1196-03 1 mL

MBP Antibody

Sign In for Pricing
View Details
CD117 (Cocktail), CF594 conjugate, 0.1mg/mL
BNC941018-500 1x 500 µL

CD117 (Cocktail), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS707449 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details