Recombinant Rat E3 ubiquitin-protein ligase RNF5 (Rnf5)
This Recombinant Rat E3 ubiquitin-protein ligase RNF5 (Rnf5) spans the amino acid sequence from region 2-180.
Product Specifications
Product Name Alternative
E3 ubiquitin-protein ligase RNF5, EC= 6.3.2.-, RING finger protein 5
UniProt
Q5M807
Expression Region
2-180
Origin
Rattus norvegicus (Rat)
Field of Research
Molecular Biology; Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
AAAEEEDGGPEGPNRERGGASATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPDR QECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDAGGFH FSFGVGAFPFGFFTTVFNAHEPFRRGAGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740043-500 1x 500 µL
P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880218-100 1x 100 µL
CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880050-100 1x 100 µL
IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740183-100 1x 100 µL
Cytochrome C (Mitochondrial Marker) (7H8.2C12), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details