Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryza sativa subsp. japonica Cytochrome b6-f complex iron-sulfur subunit, chloroplastic (petC)

This Recombinant Oryza sativa subsp. japonica Cytochrome b6-f complex iron-sulfur subunit, chloroplastic (petC) spans the amino acid sequence from region 47-225.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex iron-sulfur subunit, chloroplastic, EC= 1.10.9.1, Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein, Rieske iron-sulfur protein, ISP, Shor

UniProt

Q69S39

Expression Region

47-225

Origin

Oryza sativa subsp. japonica (Rice)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AASSIPADRVPDMGKRQLMNLLLLGAISLPTVGMLVPYGAFFIPAGSGNAGGGQVAKDKL GNDVLAEEWLKTHGPNDRTLTQGLKGDPTYLVVEADKTLATYGINAVCTHLGCVVPWNAA ENKFICPCHGSQYNNQGRVVRGPAPLSLALVHADVDDGKVLFVPWVETDFRTGDNPWWA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL
BNC402216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL
BNC940304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL
BNC741073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL
BNC680669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF640R conjugate, 0.1mg/mL
BNC400871-100 1x 100 µL

CD71 (66IG10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (LAMP3/968), CF488A conjugate, 0.1mg/mL
BNC880968-500 1x 500 µL

CD63 (LAMP3/968), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details