Recombinant Encephalitozoon cuniculi Uncharacterized membrane protein ECU09_1950 (ECU09_1950)
This Recombinant Encephalitozoon cuniculi Uncharacterized membrane protein ECU09_1950 (ECU09_1950) spans the amino acid sequence from region 1-179.
Product Specifications
Product Name Alternative
Uncharacterized membrane protein ECU09_1950
UniProt
Q8STK5
Expression Region
1-179
Origin
Encephalitozoon cuniculi (strain GB-M1) (Microsporidian parasite)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MDCLRKQAEKIPILDAIEKRMNIRKEYALLGISFFCLVIIMATSLGPLITSTVGIIVPLQ ETLVILRQVNPKKDEAKHMLVFWMVFGILTSLDAYSGAIISFIPLWYTMKFFFLLWAGPL KFRGGIIIYDNILARIPEKWYREEGGIEHAVKKATDAVKTVAESEFNKKDVIESSKKTD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680029-100 1x 100 µL
Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680806-500 1x 500 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402210-500 1x 500 µL
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/2210R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details