Recombinant Bacillus halodurans UPF0316 protein BH0621 (BH0621)
This Recombinant Bacillus halodurans UPF0316 protein BH0621 (BH0621) spans the amino acid sequence from region 1-179.
Product Specifications
Product Name Alternative
UPF0316 protein BH0621
UniProt
Q9KF65
Expression Region
1-179
Origin
Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MVSFFMEHALTMILIILIINVVYVTLFTVRMIFTLKNQRYLAATVSMIEIIVYVLGLSLV LDNLDRIENLIAYAVGYGIGVITGMKVEEKLALGYITVNVITKEYEPDIPNTLRDKGYGV TNWVAYGREGERLMMEILTSRKSEADLYATIKKLDPKAFIISHEPKTFFGGFWVKGIRR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681003-500 1x 500 µL
Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681073-500 1x 500 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040630-500 1x 500 µL
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC801037-100 1x 100 µL
CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL
Sign In for Pricing
View Details