Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechocystis sp. Uncharacterized protein slr1261 (slr1261)

This Recombinant Synechocystis sp. Uncharacterized protein slr1261 (slr1261) spans the amino acid sequence from region 1-179.

Product Specifications

Product Name Alternative

Uncharacterized protein slr1261

UniProt

P73801

Expression Region

1-179

Origin

Synechocystis sp. (strain PCC 6803 / Kazusa)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASSTQTNVTIAPKTLQQLRQQDAVILVDVREPLEFVGEHITDAYSLPLSRLNPSQLPQA EGKTTVLYCQSSNRSGNALQQLRSAGVEGIIHLEGGLLAWKQAGLPTVKTKNAPISIMRQ VQIIAGSLVLTGVLLGSFVAPGFYFLSGFVGAGLLFAGLSGTCMMANLLGKLPYNQIKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL
BNC680645-100 1x 100 µL

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL
BNC680633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL
BNC881050-500 1x 500 µL

CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL
BNC880003-500 1x 500 µL

CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (CD5/54/F6), CF568 conjugate, 0.1mg/mL
BNC680746-100 1x 100 µL

CD5 (CD5/54/F6), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), Biotin conjugate, 0.1mg/mL
BNCB1429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details