Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodobacter sphaeroides ATP synthase subunit b' (atpG)

This Recombinant Rhodobacter sphaeroides ATP synthase subunit b' (atpG) spans the amino acid sequence from region 1-180.

Product Specifications

Product Name Alternative

ATP synthase subunit b', ATP synthase F (0) sector subunit b', ATPase subunit II, F-type ATPase subunit b', F-ATPase subunit b'

UniProt

A4WNY8

Expression Region

1-180

Origin

Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METEVHEAAGAAGHAGQAVGMPQLNFDYWPNQIFWLLVTLVAIYFLLTRVALPRIGAVLA ERRGTITNDLAAAEELKQKAVLAEKAYNEALAKARAEAQAIIAETRAAIQAELAVATAKA DAEIAAKSAESESRISEIRAGALQSVTEVAKDTAEALVAALGGKSDAASVDAAVAARMKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Angiostatin ELISA Kit
MBS022234 Inquire

Chicken Angiostatin ELISA Kit

Sign In for Pricing
View Details
ALK Antibody
orb1332544 100 µg

ALK Antibody

Sign In for Pricing
View Details
PTCH1 Protein Lysate (Mouse) with C-HA Tag
38062034 100 µg

PTCH1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Gipr Recombinant Monoclonal Antibody [12C6]
A73944-100 100 µL

Gipr Recombinant Monoclonal Antibody [12C6]

Sign In for Pricing
View Details
3- (beta-D-Glucopyranosyloxy) -1,6-dihydroxy-2-methyl-9,10-anthracenedione
M32258-01 100 mg

3- (beta-D-Glucopyranosyloxy) -1,6-dihydroxy-2-methyl-9,10-anthracenedione

Sign In for Pricing
View Details
3- (beta-D-Glucopyranosyloxy) -1,6-dihydroxy-2-methyl-9,10-anthracenedione
M32258-02 50 mg

3- (beta-D-Glucopyranosyloxy) -1,6-dihydroxy-2-methyl-9,10-anthracenedione

Sign In for Pricing
View Details