Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta gronovii ATP synthase subunit b, plastid (atpF)

This Recombinant Cuscuta gronovii ATP synthase subunit b, plastid (atpF) spans the amino acid sequence from region 1-180.

Product Specifications

Product Name Alternative

ATP synthase subunit b, plastid, ATP synthase F (0) sector subunit b, ATPase subunit I

UniProt

A7M8Z0

Expression Region

1-180

Origin

Cuscuta gronovii (Common dodder)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKDVTYYLISLASQSPAGSFGLNTNNLVTTLINIAVVLSLLIVFGKGFLRDFLDTRKNRI VNTIQISDELYSGAVEKLEKAQARLCKVEKEAKQLRVTGYSEIEQEKLNLINSTYKTLER LEKKKKETCSFEQQRAINDVRQWVLQQTLQRVLKTLNGSLNPELHLHTIRVNISMLGTLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOX11 (TLX1) Rabbit Polyclonal Antibody
TA382575 100 µL

HOX11 (TLX1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NDUFS8 (NM_002496) Human Over-expression Lysate
LC400889 20 µg

NDUFS8 (NM_002496) Human Over-expression Lysate

Sign In for Pricing
View Details
(1S)-1-[4-(Propan-2-yloxy)phenyl]ethan-1-amine
TRC-S683668-50MG 50 mg

(1S)-1-[4-(Propan-2-yloxy)phenyl]ethan-1-amine

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS651148 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
ZG16B Human Gene Knockout Kit (CRISPR)
KN202244 1 Kit

ZG16B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PARP1 (N-term) Rabbit Polyclonal Antibody
AP13461PU-N 400 µL

PARP1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details