Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta obtusiflora ATP synthase subunit b, chloroplastic (atpF)

This Recombinant Cuscuta obtusiflora ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-180.

Product Specifications

Product Name Alternative

ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I

UniProt

A8W3H6

Expression Region

1-180

Origin

Cuscuta obtusiflora (Peruvian dodder)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNDVTYYLISLASQSPAGSFGLNTNNLVTTLINIGVVLCLLIIFGKGFLRNFLDTRKNKI VNTMQISDELYSSAVEKLEKAQARLCKVENEAKQLRVTGYSEIEHEKLNLINSTYKTLER LEKKKKETCSFEQQQAFNDVRQWVLQQTLQRVLKTLNGSFNPELHLRTIRINISMLGTLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Campylobacter Concisus rpsZ Protein (aa 1-61)
VAng-Lsx5906-50gEcoli 50 µg (E. coli)

Recombinant Campylobacter Concisus rpsZ Protein (aa 1-61)

Sign In for Pricing
View Details
SEPHS2 Lentiviral Activation Particles (h)
sc-406316-LAC 200 µL

SEPHS2 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
SCO2 Recombinant Protein (Human)
OPCA03950-100UG 100 µg

SCO2 Recombinant Protein (Human)

Sign In for Pricing
View Details
Goat Stromal Cell Derived Factor 1Beta ELISA Kit
MBS045666 Inquire

Goat Stromal Cell Derived Factor 1Beta ELISA Kit

Sign In for Pricing
View Details
5-Methoxyquinoline
FM42335-01 25 g

5-Methoxyquinoline

Sign In for Pricing
View Details
5-Methoxyquinoline
FM42335-02 50 g

5-Methoxyquinoline

Sign In for Pricing
View Details