Recombinant Treponema pallidum Uncharacterized protein TP_0335 (TP_0335)
This Recombinant Treponema pallidum Uncharacterized protein TP_0335 (TP_0335) spans the amino acid sequence from region 1-180.
Product Specifications
Product Name Alternative
Uncharacterized protein TP_0335
UniProt
O83355
Expression Region
1-180
Origin
Treponema pallidum (strain Nichols)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAITTAGDICALYPLCPILLHCSTLMHLSPLRNTPHVLHAAAAVTEYAFVLSTLVFPSFC FSLPSPFPFPEGEGGAFYVRLFLNALSEEVLFRAYIPERLCHHATSCTARACGEVLSVLL FALAHRPAGSATLFAGAAGAALRVLFVREKKRSGSRARASALCTAVHALWNAYAIAAAAR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400034-500 1x 500 µL
Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740676-100 1x 100 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400146-100 1x 100 µL
CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880204-100 1x 100 µL
Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681775-100 1x 100 µL
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/1775R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details