Recombinant Xenopus laevis Transmembrane protein 85 (tmem85)
This Recombinant Xenopus laevis Transmembrane protein 85 (tmem85) spans the amino acid sequence from region 1-180.
Product Specifications
Product Name Alternative
Transmembrane protein 85
UniProt
Q6GR43
Expression Region
1-180
Origin
Xenopus laevis (African clawed frog)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MATPTNLVTNRGRRFKWAIEFGSGGSRGRGERGGLQDSMYPVGYSDKQVPDTSVQESDHI LVEKRCWDIALGPLKQIPMNLFIMYMAGNTISIFPIMMVCMMAWRPIQALLATPATFKLL ESSGQRFLQGLVYLIGNLLGLALGVYKCQSMGLLPTHASDWLAFIEPPERMEYTGGGFLL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC041231-500 1x 500 µL
Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680031-500 1x 500 µL
Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400912-500 1x 500 µL
NGFR (Nerve Growth Factor Receptor) (NTR/912), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details