Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit b (atpF)

This Recombinant Synechococcus sp. ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-180.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q2JSV9

Expression Region

1-180

Origin

Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPAWLLAVAEPVTEATEGSAEKGILDAILESNLINIAIILSLLYILGRRVVGEALAKRRE GILEELRQAEQRKQEAIERLAEEQQKLAQAQQEAERIRKQAEANAEARRQELLQQAEREI ERLRANAERDLSAEQEQILQELRRQIVRQALSKVEQELPQHLNEQVHQRLIERGIQMIAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS26B Antibody
CSB-PA676824LA01HU 100 µL

VPS26B Antibody

Sign In for Pricing
View Details
Human anti-Gamma-aminobutyric acid (GABA) A receptor, alpha 5 antibody ELISA Kit
MBS7273429-01 48 Well

Human anti-Gamma-aminobutyric acid (GABA) A receptor, alpha 5 antibody ELISA Kit

Sign In for Pricing
View Details
Human anti-Gamma-aminobutyric acid (GABA) A receptor, alpha 5 antibody ELISA Kit
MBS7273429-02 96 Well

Human anti-Gamma-aminobutyric acid (GABA) A receptor, alpha 5 antibody ELISA Kit

Sign In for Pricing
View Details
Human anti-Gamma-aminobutyric acid (GABA) A receptor, alpha 5 antibody ELISA Kit
MBS7273429-03 5x 96 Well

Human anti-Gamma-aminobutyric acid (GABA) A receptor, alpha 5 antibody ELISA Kit

Sign In for Pricing
View Details
Human anti-Gamma-aminobutyric acid (GABA) A receptor, alpha 5 antibody ELISA Kit
MBS7273429-04 10x 96 Well

Human anti-Gamma-aminobutyric acid (GABA) A receptor, alpha 5 antibody ELISA Kit

Sign In for Pricing
View Details
N6-Benzoyl-3'-deoxy-3'-fluoroadenosine
orb1907760-01 5 mg

N6-Benzoyl-3'-deoxy-3'-fluoroadenosine

Sign In for Pricing
View Details