Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit b (atpF)

This Recombinant Synechococcus sp. ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-180.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q2JSV9

Expression Region

1-180

Origin

Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPAWLLAVAEPVTEATEGSAEKGILDAILESNLINIAIILSLLYILGRRVVGEALAKRRE GILEELRQAEQRKQEAIERLAEEQQKLAQAQQEAERIRKQAEANAEARRQELLQQAEREI ERLRANAERDLSAEQEQILQELRRQIVRQALSKVEQELPQHLNEQVHQRLIERGIQMIAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFM1 (Elongation Factor G, Mitochondrial, G Elongation Factor, Mitochondrial 1)
481737 100 µL

GFM1 (Elongation Factor G, Mitochondrial, G Elongation Factor, Mitochondrial 1)

Sign In for Pricing
View Details
1,3-Bis (3-boronophenyl) urea
410970-01 100 mg

1,3-Bis (3-boronophenyl) urea

Sign In for Pricing
View Details
1,3-Bis (3-boronophenyl) urea
410970-02 250 mg

1,3-Bis (3-boronophenyl) urea

Sign In for Pricing
View Details
ALDH18A1 Protein Vector (Human) (pPB-C-His)
PV061845 500 ng

ALDH18A1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Anti-CDK7 Rabbit mAb
CMA5481-01 30 µL

Recombinant Anti-CDK7 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-CDK7 Rabbit mAb
CMA5481-02 50 μL

Recombinant Anti-CDK7 Rabbit mAb

Sign In for Pricing
View Details