Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodobacter sphaeroides ATP synthase subunit b' (atpG)

This Recombinant Rhodobacter sphaeroides ATP synthase subunit b' (atpG) spans the amino acid sequence from region 1-180.

Product Specifications

Product Name Alternative

ATP synthase subunit b', ATP synthase F (0) sector subunit b', ATPase subunit II, F-type ATPase subunit b', F-ATPase subunit b'

UniProt

Q3IZ14

Expression Region

1-180

Origin

Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METEVHEAAGAAGHAGQAVGMPQLNFDYWPNQIFWLLVTLVAIYFLLTRVALPRIGAVLA ERRGTITNDLAAAEELKQKAVLAEKAYNEALAKARAEAQAIVAETRAAIQAELDEATAKA DAEISAKSAESEARIAEIRAGALQSVSEVAKDTAEALVAALGGKSDAAAVDAAVAARMKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Poly-L-lysine Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Clear PS
MG12F-LYS-L 10x 96 Well Plates

Poly-L-lysine Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Clear PS

Sign In for Pricing
View Details
Zfp457 Mouse Gene Knockout Kit (CRISPR)
KN519846 1 Kit

Zfp457 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human CD97 Protein (His Tag)
PKSH031169 100 µg

Recombinant Human CD97 Protein (His Tag)

Sign In for Pricing
View Details
LSM1 (NM_014462) Human Recombinant Protein
TP720235 10 µg

LSM1 (NM_014462) Human Recombinant Protein

Sign In for Pricing
View Details
Rad9a Mouse Gene Knockout Kit (CRISPR)
KN514424 1 Kit

Rad9a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tau (MAPT) Rabbit Polyclonal Antibody
TA378334 100 µL

Tau (MAPT) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details