Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable signal peptidase complex subunit 2 (CBG15767)

This Recombinant Probable signal peptidase complex subunit 2 (CBG15767) spans the amino acid sequence from region 1-180.

Product Specifications

Product Name Alternative

Probable signal peptidase complex subunit 2, EC= 3.4.-.-, Microsomal signal peptidase 25 kDa subunit, SPase 25 kDa subunit

UniProt

Q615A2

Expression Region

1-180

Origin

Caenorhabditis briggsae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDERITVVNKWDGPTVKNGLDEVVKKILNDKVGWTEQHNLMNLRLLISFIGVAFSAFAC GYDFYAPFPKSKIVLLVCSVSYFICMGVLQLFQWYVEKDCFYEANEVDGKQTRKWAWSSE IKAHDDKYVLSAEFKKEGRSGQGKIIKSIGAYIDNDGEIMIPLVQREVDDLWARLIRSEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ApoO Antibody
BF0668-01 50 µL

ApoO Antibody

Sign In for Pricing
View Details
ApoO Antibody
BF0668-02 100 µL

ApoO Antibody

Sign In for Pricing
View Details
ApoO Antibody
BF0668-03 200 µL

ApoO Antibody

Sign In for Pricing
View Details
MIR8109 Mouse qPCR Primer Pair (MI0026041)
MP301188 200 Reactions

MIR8109 Mouse qPCR Primer Pair (MI0026041)

Sign In for Pricing
View Details
Chlorantraniliprole
CS-T-50532 1 Each

Chlorantraniliprole

Sign In for Pricing
View Details
Cadherin 26 (CDH26) Antibody
abx231549 100 µg

Cadherin 26 (CDH26) Antibody

Sign In for Pricing
View Details