Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit b (atpF)

This Recombinant ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-180.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q82J80

Expression Region

1-180

Origin

Streptomyces avermitilis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MILVQLAAEEAQNPLIPEVPELVIGLLAFAIVFFVLGKKLLPNINKVLEERRAAIEGGIE EAEAMKVEAQSVLEQYKAQLAEARHEAARLRQEAQEQGATLITEMRAEGQRQREEIIAAG HAQLEADRKAAAQALRQDVGTLATDLAGKLVGESLEDHARQSRVIDRFLDGLEEKAEATR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLJ20259 Polyclonal Antibody
MBS9235696-01 0.1 mL

FLJ20259 Polyclonal Antibody

Sign In for Pricing
View Details
FLJ20259 Polyclonal Antibody
MBS9235696-02 5x 0.1 mL

FLJ20259 Polyclonal Antibody

Sign In for Pricing
View Details
Indoleamine 2,3-Dioxygenase/IDO/INDO
E21-P06 10 µg

Indoleamine 2,3-Dioxygenase/IDO/INDO

Sign In for Pricing
View Details
RASGRP3 (NM_001139488) Human Tagged ORF Clone
RG227703 10 µg

RASGRP3 (NM_001139488) Human Tagged ORF Clone

Sign In for Pricing
View Details
2- (Benzo[d][1,3]dioxol-5-yl) quinoline-4-carboxylic acid
OR1054746-01 250 mg

2- (Benzo[d][1,3]dioxol-5-yl) quinoline-4-carboxylic acid

Sign In for Pricing
View Details
2- (Benzo[d][1,3]dioxol-5-yl) quinoline-4-carboxylic acid
OR1054746-02 1 g

2- (Benzo[d][1,3]dioxol-5-yl) quinoline-4-carboxylic acid

Sign In for Pricing
View Details