Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Sporulation-specific protein spo7 (spo7)

This Recombinant Schizosaccharomyces pombe Sporulation-specific protein spo7 (spo7) spans the amino acid sequence from region 1-180.

Product Specifications

Product Name Alternative

Sporulation-specific protein spo7

UniProt

Q9USQ0

Expression Region

1-180

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSYVPNTLSVYHNLLILEASFRKTYLQLQVRRQKYMAFYVSLLVWNFYFGYRVFYRISK YSLIDLTYKLCLLCGIVTLLLFYFSGLYRTTIVYPSRYVQQVNKAMRFFNIRLVITPVPW FQVRKPLDCGVHLILSSKRFDILVIEGWEAFRSSYFASIHRKNNSIQSNESSESPSSKQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Cyclin-I2 (CCNI2) ELISA Kit
MBS7237794-01 48 Well

Monkey Cyclin-I2 (CCNI2) ELISA Kit

Sign In for Pricing
View Details
Monkey Cyclin-I2 (CCNI2) ELISA Kit
MBS7237794-02 96 Well

Monkey Cyclin-I2 (CCNI2) ELISA Kit

Sign In for Pricing
View Details
Monkey Cyclin-I2 (CCNI2) ELISA Kit
MBS7237794-03 5x 96 Well

Monkey Cyclin-I2 (CCNI2) ELISA Kit

Sign In for Pricing
View Details
Monkey Cyclin-I2 (CCNI2) ELISA Kit
MBS7237794-04 10x 96 Well

Monkey Cyclin-I2 (CCNI2) ELISA Kit

Sign In for Pricing
View Details
GRM6 (Metabotropic Glutamate Receptor 6, Glutamate Receptor, Metabotropic 6)
482281 100 µL

GRM6 (Metabotropic Glutamate Receptor 6, Glutamate Receptor, Metabotropic 6)

Sign In for Pricing
View Details
Recombinant Human TRPV3 Protein, N-His
orb3060740-01 50 µg

Recombinant Human TRPV3 Protein, N-His

Sign In for Pricing
View Details