Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Banna virus Non-structural protein 4 (S11)

This Recombinant Banna virus Non-structural protein 4 (S11) spans the amino acid sequence from region 1-180.

Product Specifications

Product Name Alternative

Non-structural protein 4, NS4, VP11

UniProt

Q9YWQ3

Expression Region

1-180

Origin

Banna virus (strain Indonesia/JKT-6423/1980) (BAV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIQVQNLNCCPGRFVCVHKMTLLIILIISAAVTVIDQLYQKLPYDEQTKYIVSTITDGI NATIISVMAILGLNNLNRVRYSKLDENGVYSQEMVTMNVQSDAANNKKQLKKKENEDVDE EKGLYPNLKLTEPTAPMIHNYMYDHKTQQAYLLTEHQIEQIKQNSVDPNNTPKIEVRSQF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mix-n-StainTM CF®405L IgM Antibody Labeling Kits, 1x100ug labeling
#92559 1 Kit

Mix-n-StainTM CF®405L IgM Antibody Labeling Kits, 1x100ug labeling

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS629491 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Human GDAP2 activation kit by CRISPRa
GA110297 1 Kit

Human GDAP2 activation kit by CRISPRa

Sign In for Pricing
View Details
HP1 alpha (CBX5) Rabbit Polyclonal Antibody
AP06694PU-N 100 µg

HP1 alpha (CBX5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAGED1 Antibody (Biotin)
KB-11536-01 50 μL

MAGED1 Antibody (Biotin)

Sign In for Pricing
View Details
MAGED1 Antibody (Biotin)
KB-11536-02 100 µL

MAGED1 Antibody (Biotin)

Sign In for Pricing
View Details