Recombinant Thalassiosira pseudonana Photosystem I assembly protein Ycf4 (ycf4)
This Recombinant Thalassiosira pseudonana Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-181.
Product Specifications
Product Name Alternative
Photosystem I assembly protein Ycf4
UniProt
A0T0U3
Expression Region
1-181
Origin
Thalassiosira pseudonana (Marine diatom) (Cyclotella nana)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MQDQIRQEKIVGSRRFSNYFWASLLLVGGLMFLLAGISSYLKINLLPFANTTELVFIPQG IVMMFYGTLSFGLSIYIMATLFWDIGSGYNEYNKVENLVKVVRRGFPGKNREILLTYPLN NIRSIGIKISEGLNPQRIIYLCLKDERKIPLTPVQQPDSISDLEDQAADLAKFLDLKLEN L
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740270-100 1x 100 µL
Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040391-500 1x 500 µL
CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040806-100 1x 100 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941429-500 1x 500 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 