Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2025 (AF_2025)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2025 (AF_2025) spans the amino acid sequence from region 1-181.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_2025

UniProt

O28254

Expression Region

1-181

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVDLDEFEVVLEELVKEVKRRDTIAAVLISTSFVLFGFLALVLLNVIRLEEFMRGIVAIV SLIAIWVLMTAGVYILLSMPLPELPTRIVADSKGVMELMKRNYGGKIYITRQSYRNLPPK VGARMNLEIVDVSDEEVAKYLNHGVELAESIAAAKKLKAKVVSDRKMKVDGVEIIKAEDL F

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-L-tyrosine disodium
FP180928-01 10 g

Phospho-L-tyrosine disodium

Sign In for Pricing
View Details
Phospho-L-tyrosine disodium
FP180928-02 25 g

Phospho-L-tyrosine disodium

Sign In for Pricing
View Details
Phospho-L-tyrosine disodium
FP180928-03 50 g

Phospho-L-tyrosine disodium

Sign In for Pricing
View Details
Phospho-L-tyrosine disodium
FP180928-04 100 g

Phospho-L-tyrosine disodium

Sign In for Pricing
View Details
Phospho-L-tyrosine disodium
FP180928-05 250 g

Phospho-L-tyrosine disodium

Sign In for Pricing
View Details
Human SH3 and multiple ankyrin repeat domains protein 3 (SHANK3) Elisa Kit
EK713686 96 Well

Human SH3 and multiple ankyrin repeat domains protein 3 (SHANK3) Elisa Kit

Sign In for Pricing
View Details