Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Daucus carota ATP synthase subunit b, chloroplastic (atpF)

This Recombinant Daucus carota ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-181.

Product Specifications

Product Name Alternative

ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I

UniProt

Q0G9X6

Expression Region

1-181

Origin

Daucus carota (Carrot)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNVTDSFVSLGHWPSAGSFGFNTDILATNLINLSVVLGVLVFFGKGVLSDLLDNRKQRI LNTIRNSEELRGGAIEQLEKARTRLRKVEMEADQFRVNGYSEIERERLNFINSTSKTLKQ LENYKNETINFEQQRAINQVRQLVFQQALQGALGTLSSCLNNELHLRTIRANIGMLGAIT D

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIMS2 (NM_001161404) Human Over-expression Lysate
LC431854 20 µg

LIMS2 (NM_001161404) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human GADD45A protein (His tag)
PDEH100957-01 20 µg

Recombinant Human GADD45A protein (His tag)

Sign In for Pricing
View Details
Recombinant Human GADD45A protein (His tag)
PDEH100957-02 100 µg

Recombinant Human GADD45A protein (His tag)

Sign In for Pricing
View Details
Recombinant Human GADD45A protein (His tag)
PDEH100957-03 500 µg

Recombinant Human GADD45A protein (His tag)

Sign In for Pricing
View Details
Recombinant Human GADD45A protein (His tag)
PDEH100957-04 1 mg

Recombinant Human GADD45A protein (His tag)

Sign In for Pricing
View Details
TTK Rabbit Polyclonal Antibody
HA500249 100 µL

TTK Rabbit Polyclonal Antibody

Sign In for Pricing
View Details