Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit b (atpF)

This Recombinant ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-181.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

P50013

Expression Region

1-181

Origin

Streptomyces lividans

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSPMLQIAAEEMENPLIPPIPELVIGLIAFVIVFGFLAKKLLPNINKVLEERREAIEGGI EKAEAAQTEAQSVLEQYKAQLAEARHEGREEAQEQGATLIAEMRAEGQRQREEIIAAGHA QIQADRKAAASALRQDVGKLATELAGKLVGESLEDHARQSRVIDRFLDELDDKATTAEAT R

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Hydroxyisoquinoline-1,3(2H,4H)-dione
TRC-H939800-10MG 10 mg

2-Hydroxyisoquinoline-1,3(2H,4H)-dione

Sign In for Pricing
View Details
NUDT12 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A2]
TA805547AM 100 µL

NUDT12 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A2]

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS622501 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
Alpha 1 microglobuLin (AMBP) (NM_001633) Human Recombinant Protein
TP308342L 1 mg

Alpha 1 microglobuLin (AMBP) (NM_001633) Human Recombinant Protein

Sign In for Pricing
View Details
Dibutyl L-Tartrate
TRC-D429540-25G 25 g

Dibutyl L-Tartrate

Sign In for Pricing
View Details
p16INK4A (CDKN2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F6]
TA802246AM 100 µL

p16INK4A (CDKN2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F6]

Sign In for Pricing
View Details