Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Helianthus annuus Oleosin

This Recombinant Helianthus annuus Oleosin spans the amino acid sequence from region 1-181.

Product Specifications

Product Name Alternative

Oleosin

UniProt

P29529

Expression Region

1-181

Origin

Helianthus annuus (Common sunflower)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TTTTYDRHFTTTQPHYRQDDRSRYDQQTHSQSTSRTLAIIALLPVGGILLGLAALTFIGT LIGLALATPLFVIFSPIIVPAVLTIGLAVTGFLASGTFGLTGLSSLSYLFNMVRQTAGSV PESLDYVKGTLQDAGEYAGQKTKDFGQKIQSTAHEMGDQGQVGVHAQVGGGKEGRKSGDR T

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCEAL2 Polyclonal Antibody
E-AB-90602-01 60 µL

TCEAL2 Polyclonal Antibody

Sign In for Pricing
View Details
TCEAL2 Polyclonal Antibody
E-AB-90602-02 120 µL

TCEAL2 Polyclonal Antibody

Sign In for Pricing
View Details
TCEAL2 Polyclonal Antibody
E-AB-90602-03 200 µL

TCEAL2 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human ANPEP/CD13 Protein (603 Met/Ile, His Tag)
PKSH031912 50 µg

Recombinant Human ANPEP/CD13 Protein (603 Met/Ile, His Tag)

Sign In for Pricing
View Details
PPP2R5B (NM_006244) Human Recombinant Protein
TP306889L 1 mg

PPP2R5B (NM_006244) Human Recombinant Protein

Sign In for Pricing
View Details
Anti-Rat Ig Kappa light chain Antibody
KC-2674-01 50 μL

Anti-Rat Ig Kappa light chain Antibody

Sign In for Pricing
View Details