Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein F02A9.1 (F02A9.1)

This Recombinant Uncharacterized protein F02A9.1 (F02A9.1) spans the amino acid sequence from region 20-200.

Product Specifications

Product Name Alternative

Uncharacterized protein F02A9.1

UniProt

P34380

Expression Region

20-200

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

INNQNSRYDKMFLAMVCQDQNGCEVNIRFLKQSFPDSNSTEPLYEHTMIYNNGSLDEITI DVTEDVNIIEFTFTAPDENGTTIVETDSWELNFSETYFHTIGSLQLVGNLPCGRYGCPQT PLCNGSCRFMVIVSLAAFCISVLAGLALQTVYVSFLGFRKTRKAVELRDTLRLTEAAELA H

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Adiponectin (ADP) ELISA Kit
RD-ADP-Mu-01 96 Tests

Mouse Adiponectin (ADP) ELISA Kit

Sign In for Pricing
View Details
Mouse Adiponectin (ADP) ELISA Kit
RD-ADP-Mu-02 48 Tests

Mouse Adiponectin (ADP) ELISA Kit

Sign In for Pricing
View Details
Acetylcholine-1,1,2,2-d4 Bromide
TRC-A172072-10MG 10 mg

Acetylcholine-1,1,2,2-d4 Bromide

Sign In for Pricing
View Details
Mouse vWF (von Willebrand Factor) CLIA Kit
E-CL-M0686-01 24 Tests

Mouse vWF (von Willebrand Factor) CLIA Kit

Sign In for Pricing
View Details
Mouse vWF (von Willebrand Factor) CLIA Kit
E-CL-M0686-02 48 Tests

Mouse vWF (von Willebrand Factor) CLIA Kit

Sign In for Pricing
View Details
Mouse vWF (von Willebrand Factor) CLIA Kit
E-CL-M0686-03 96 Tests

Mouse vWF (von Willebrand Factor) CLIA Kit

Sign In for Pricing
View Details