Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein F02A9.1 (F02A9.1)

This Recombinant Uncharacterized protein F02A9.1 (F02A9.1) spans the amino acid sequence from region 20-200.

Product Specifications

Product Name Alternative

Uncharacterized protein F02A9.1

UniProt

P34380

Expression Region

20-200

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

INNQNSRYDKMFLAMVCQDQNGCEVNIRFLKQSFPDSNSTEPLYEHTMIYNNGSLDEITI DVTEDVNIIEFTFTAPDENGTTIVETDSWELNFSETYFHTIGSLQLVGNLPCGRYGCPQT PLCNGSCRFMVIVSLAAFCISVLAGLALQTVYVSFLGFRKTRKAVELRDTLRLTEAAELA H

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11d (ITGAD) (NM_005353) Human Recombinant Protein
TP324758M 100 µg

CD11d (ITGAD) (NM_005353) Human Recombinant Protein

Sign In for Pricing
View Details
ZC3H12A Polyclonal Antibody
E-AB-90448-01 60 µL

ZC3H12A Polyclonal Antibody

Sign In for Pricing
View Details
ZC3H12A Polyclonal Antibody
E-AB-90448-02 120 µL

ZC3H12A Polyclonal Antibody

Sign In for Pricing
View Details
ZC3H12A Polyclonal Antibody
E-AB-90448-03 200 µL

ZC3H12A Polyclonal Antibody

Sign In for Pricing
View Details
Claudin 3 (CLDN3) Mouse Monoclonal Antibody [Clone ID: OTI2D4]
CF806523 100 µg

Claudin 3 (CLDN3) Mouse Monoclonal Antibody [Clone ID: OTI2D4]

Sign In for Pricing
View Details
Mouse Tslrn1 activation kit by CRISPRa
GA210255 1 Kit

Mouse Tslrn1 activation kit by CRISPRa

Sign In for Pricing
View Details