Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium sp. Uncharacterized protein y4yS (NGR_a00520)

This Recombinant Rhizobium sp. Uncharacterized protein y4yS (NGR_a00520) spans the amino acid sequence from region 1-182.

Product Specifications

Product Name Alternative

Uncharacterized protein y4yS

UniProt

P55727

Expression Region

1-182

Origin

Rhizobium sp. (strain NGR234)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSHENRVAAPLLSFRLSLVLFAVLSVLPLGGCARWDNPVLSVKETSAAQLLGANQINAA TRQRILRAVGEDAQERALRDDLKQHPGNVDAAIRLTKALVAQKRPHEALQVLDNVLVVTP DNLRALNAKAVILDIEGRHDAAQELYRQALETNPENQMLHHNLHLSLAFEGKSEQRTLPQ SR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPK9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1267707 1.0 µg DNA

MAPK9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Recombinant Human ulBP-02 Protein, His Tag
KMP1587 50 µg

Recombinant Human ulBP-02 Protein, His Tag

Sign In for Pricing
View Details
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 Polyclonal Antibody
orb359706 100 µg

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 Polyclonal Antibody

Sign In for Pricing
View Details
Human Heme oxygenase 1 (HO-1) ELISA Kit
MBS285793-01 48 Tests

Human Heme oxygenase 1 (HO-1) ELISA Kit

Sign In for Pricing
View Details
Human Heme oxygenase 1 (HO-1) ELISA Kit
MBS285793-02 96 Tests

Human Heme oxygenase 1 (HO-1) ELISA Kit

Sign In for Pricing
View Details
Human Heme oxygenase 1 (HO-1) ELISA Kit
MBS285793-03 5x 96 Tests

Human Heme oxygenase 1 (HO-1) ELISA Kit

Sign In for Pricing
View Details