Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus thuringiensis UPF0316 protein BALH_3038 (BALH_3038)

This Recombinant Bacillus thuringiensis UPF0316 protein BALH_3038 (BALH_3038) spans the amino acid sequence from region 1-182.

Product Specifications

Product Name Alternative

UPF0316 protein BALH_3038

UniProt

A0RGF6

Expression Region

1-182

Origin

Bacillus thuringiensis (strain Al Hakam)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAAVGLLEGAIYIVSLGIVFQDLSNWMN IVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGIN SIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDHH VS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF740 conjugate, 0.1mg/mL
BNC740151-100 1x 100 µL

CD11a (Cris-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL
BNC050391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL
BNC740003-500 1x 500 µL

CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF640R conjugate, 0.1mg/mL
BNC400039-100 1x 100 µL

CD34 (ICO-115), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44v4 (Marker of Tumor Metastasis) (CD44v4/1700R), CF488A conjugate, 0.1mg/mL
BNC881700-500 1x 500 µL

CD44v4 (Marker of Tumor Metastasis) (CD44v4/1700R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Smooth Muscle Actin (ACTA2/791), CF640R conjugate, 0.1mg/mL
BNC400791-100 1x 100 µL

Smooth Muscle Actin (ACTA2/791), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details